PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G153900.3
Common NameB456_001G153900, LOC105795828
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 640aa    MW: 70959 Da    PI: 7.4425
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G153900.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3727.4e-2376176198
                         EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         f+k+lt sd++++g +++ +k+a+e+     +++ + +++l  +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   +
  Gorai.001G153900.3  76 FCKILTASDTSTHGGFSVLRKHATEClppldMNQATPTQELAAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--R 164
                         99****************************9555556679************************************************..3 PP

                         SSEE..EEEEE- CS
                  B3  87 rsefelvvkvfr 98 
                          +++el+v+++r
  Gorai.001G153900.3 165 GDNGELRVGARR 176
                         489999**9987 PP

2Auxin_resp1027.5e-34202281183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aaha++t++ F v+Y+Pr+  s+F++ v+k+++a+k+ +svGmRfkm+fe+ed + rr++Gt+vgv d++p +W++SkWr Lk
  Gorai.001G153900.3 202 AAHAVTTQTLFVVYYKPRT--SQFIIGVNKYLEAIKNGFSVGMRFKMRFEGEDTPDRRFTGTIVGVGDFSP-HWSESKWRTLK 281
                         79****************6..9*************************************************.********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.0E-3967191IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.72E-4067205IPR015300DNA-binding pseudobarrel domain
CDDcd100174.54E-1975176No hitNo description
PROSITE profilePS5086311.70276178IPR003340B3 DNA binding domain
SMARTSM010192.7E-2176178IPR003340B3 DNA binding domain
PfamPF023625.3E-2176176IPR003340B3 DNA binding domain
PfamPF065074.4E-31202281IPR010525Auxin response factor
PfamPF023091.1E-7506560IPR033389AUX/IAA domain
SuperFamilySSF542771.24E-12520600No hitNo description
PROSITE profilePS5174527.275524616IPR000270PB1 domain
PfamPF023092.2E-6568614IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    Send to blast
MEQLEASTNQ ELNNQAPLFN LPSKILCRVI HVQLLAELET DDVYAQITLQ PEADQSEPTS  60
PDPCPAEAPK RTVNSFCKIL TASDTSTHGG FSVLRKHATE CLPPLDMNQA TPTQELAAKD  120
LHGYEWRFKH IFRGQPRRHL LTTGWSTFVT SKRLVAGDAF VFLRGDNGEL RVGARRLARQ  180
QTTMPSSVIS SQSMHLGVLA TAAHAVTTQT LFVVYYKPRT SQFIIGVNKY LEAIKNGFSV  240
GMRFKMRFEG EDTPDRRFTG TIVGVGDFSP HWSESKWRTL KIQWDEPATI QRPERVSPWE  300
IEPFAPSASI NLVQPAVKNK RPRPVDIPVS EITTNSAGST FWGRGSTQSH ELTQVGSTPE  360
IQSSESQVMW GMRQKEADYS RGYNSNAWPH SPLVNVSLNL FPNSVSDKNR TEKPQTTLTG  420
YALPSLSRPS KGLMHDQVEK GKKSETSTGC RLFGFNLTDT ISAVIPTDKE QTNTTVDHNG  480
VWGSLAAASH IDQNPETAKQ KHVAAEASSK EMQAKQGAST TSTRSRTKVQ MQGIAVGRAV  540
DLTVLKGYDD LINEVEKMFD IKGELRPSGK WSVVFTDDEG DMMLVGDDPW MDFCKMVRKI  600
FIYSSEEVKK ISPRCKFAVS SLEGEGTAVT IDSEHKSET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-155130449355Auxin response factor 1
4ldw_A1e-155130449355Auxin response factor 1
4ldw_B1e-155130449355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1319323KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480949.10.0PREDICTED: auxin response factor 18 isoform X2
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A0D2PRZ90.0A0A0D2PRZ9_G
STRINGVIT_15s0046g00290.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]